Structure of PDB 7qh6 Chain E

Receptor sequence

>7qh6E (length=284) Species: 9606 (Homo sapiens)

SGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGS
FRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMAT
LSVGGKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLY
AAHFRPGQYVDVTAKTIGKGFQGVMKRWGFTGDIGRVWPGTKMPGKMGNI
YRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNL
PFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA

3D structure

• PDB: 7qh6 A late-stage assembly checkpoint of the human mitochondrial ribosome large subunit.
• Chain: E
• Resolution: 3.08 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	W48 W49 V65 D69 M106 K116 V118 V152 S153 R156 I161 Y165 Q174 V176 K177 T210 I211 G212 F215 G217 K220 R221 G246 I248 G249 R250 V251 W252 P253 G254 T255 M257 P258 K260 N263 Y265 E268 Y269 S288 H292 K293 N294 K298 K300 K303 L304 P305	W4 W5 V21 D25 M62 K72 V74 V108 S109 R112 I117 Y121 Q130 V132 K133 T166 I167 G168 F171 G173 K176 R177 G182 I184 G185 R186 V187 W188 P189 G190 T191 M193 P194 K196 N199 Y201 E204 Y205 S224 H228 K229 N230 K234 K236 K239 L240 P241

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qh6, PDBe:7qh6, PDBj:7qh6
• PDBsum: 7qh6
• PubMed: 35177605
• UniProt: P09001|RM03_HUMAN Large ribosomal subunit protein uL3m (Gene Name=MRPL3)