Structure of PDB 7piw Chain E

Receptor sequence
>7piwE (length=76) Species: 3046 (Dunaliella salina) [Search protein sequence]
ERPFSDILTSIRYWVIHSITVPSLFIAGWLFVSTGLAYDVFGSPRPNEYF
TEDRQDAPLITDRFNALEQVKKLSAQ
3D structure
PDB7piw Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes.
ChainE
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E T67 D68 N71 Q75 T61 D62 N65 Q69
BS02 HEM E F10 I13 Y19 I22 H23 L30 F4 I7 Y13 I16 H17 L24
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7piw, PDBe:7piw, PDBj:7piw
PDBsum7piw
PubMed36799903
UniProtD0FY01

[Back to BioLiP]