Structure of PDB 7pir Chain E

Receptor sequence

>7pirE (length=167) Species: 272634 (Mycoplasmoides pneumoniae M129)

MQYNIILLVDGSLSLEQANQVNEKQQQTLTNVEGLQTEYLGLKELAYPIK
KQLSAHYYRWKFSGDNQSTKDFKRTANINKQVLRELIINLEREYGYLASI
NPKKQQLALQKRAKYDEIIARENNPENPDVPVTSGLASTQPRLSRTEKAQ
KPKEELWDVVQKMGNFD

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: E
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	Y3 Y47 D65 N66 T69 K70 K73 R74 N77 I87 E93 Y94 G95 Y96 L97 S99 K103 Q106 L109 Q110 K114 N123 E126 N127 P128 D129 V130 P131 V132 S134 G135 L136 A137 S138 T139 Q140 P141	Y3 Y47 D65 N66 T69 K70 K73 R74 N77 I87 E93 Y94 G95 Y96 L97 S99 K103 Q106 L109 Q110 K114 N123 E126 N127 P128 D129 V130 P131 V132 S134 G135 L136 A137 S138 T139 Q140 P141

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: P75543|RS6_MYCPN Small ribosomal subunit protein bS6 (Gene Name=rpsF)