Structure of PDB 7ouh Chain E

Receptor sequence

>7ouhE (length=278) Species: 33747 (Simian T-lymphotropic virus 1) [Search protein sequence]

SPAKLHSFTHCGQAALTLHGATTTEALNILHSCHACRKNNPQHQMPRGHI
RRGLLPNHIWQGDITHFKYKNTLYRLHVWVDTFSGSVSATHKKRETSSEA
ISSLLHAIAHLGRPSHINTDNGPAYASQEFQHACTSLAIRHTTHIPYNPT
SSGLVERTNGILKTLLYKYFSDNPNLPMDNALSVALWTINHLNVLTHCQK
TRWQLHHSPRLPPIPEEKPVTTSKTHWYYFKIPGLNSRQWKGPQRALQEA
AGAALIPVSDTAAQWIPWKLLKRAVCPR

3D structure

PDB

7ouh Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	E	G50 H51 I52 R53 R54 T144 H146 I147 N150 T152 S153 L156 R159 T198 R204 Q250 A252 A253 G254 W267	G48 H49 I50 R51 R52 T142 H144 I145 N148 T150 S151 L154 R157 T196 R202 Q248 A250 A251 G252 W265
BS02	dna	E	T67 E158	T65 E156
BS03	dna	E	R39 N42 Q44	R37 N40 Q42
BS04	dna	E	T25 T26 P43 H45	T23 T24 P41 H43
BS05	ZN	E	H8 H12 C35	H6 H10 C33
BS06	MG	E	D65 D122	D63 D120
BS07	MG	E	D65 E158	D63 E156
BS08	KLQ	E	D65 D122 N123 P151 E158	D63 D120 N121 P149 E156

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0008270	zinc ion binding

	Biological Process
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7ouh, PDBe:7ouh, PDBj:7ouh
PDBsum	7ouh
PubMed	34404793
UniProt	Q4QY51

[Back to BioLiP]