Structure of PDB 7ouf Chain E

Receptor sequence

>7oufE (length=278) Species: 33747 (Simian T-lymphotropic virus 1)

SPAKLHSFTHCGQAALTLHGATTTEALNILHSCHACRKNNPQHQMPRGHI
RRGLLPNHIWQGDITHFKYKNTLYRLHVWVDTFSGSVSATHKKRETSSEA
ISSLLHAIAHLGRPSHINTDNGPAYASQEFQHACTSLAIRHTTHIPYNPT
SSGLVERTNGILKTLLYKYFSDNPNLPMDNALSVALWTINHLNVLTHCQK
TRWQLHHSPRLPPIPEEKPVTTSKTHWYYFKIPGLNSRQWKGPQRALQEA
AGAALIPVSDTAAQWIPWKLLKRAVCPR

3D structure

• PDB: 7ouf Structural basis for the inhibition of HTLV-1 integration inferred from cryo-EM deltaretroviral intasome structures.
• Chain: E
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	G50 H51 I52 R53 R54 T144 H146 I147 N150 T152 S153 G155 L156 R159 T198 R204 Q250 A252 A253 W267 K271	G48 H49 I50 R51 R52 T142 H144 I145 N148 T150 S151 G153 L154 R157 T196 R202 Q248 A250 A251 W265 K269
BS02	dna	E	R39 Q44 Q46	R37 Q42 Q44
BS03	dna	E	P43 R49	P41 R47
BS04	ZN	E	H8 H12 C35 C38	H6 H10 C33 C36
BS05	MG	E	D65 D122	D63 D120
BS06	MG	E	D65 E158	D63 E156
BS07	1L0	E	D65 D122 Y149 P151 E158	D63 D120 Y147 P149 E156

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:7ouf, PDBe:7ouf, PDBj:7ouf
• PDBsum: 7ouf
• PubMed: 34404793
• UniProt: Q4QY51