Structure of PDB 7ok7 Chain E

Receptor sequence
>7ok7E (length=174) Species: 10090 (Mus musculus) [Search protein sequence]
SILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIK
SVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETG
QELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQ
IQSCSALTGEGVQDGMNWVCKNVN
3D structure
PDB7ok7 The Structural and Biochemical Characterization of UNC119B Cargo Binding and Release Mechanisms.
ChainE
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP E D26 N27 A28 G29 K30 T31 T32 P47 T48 G69 G70 N126 K127 D129 L130 S159 L161 D22 N23 A24 G25 K26 T27 T28 P43 T44 G65 G66 N122 K123 D125 L126 S155 L157
BS02 MG E T31 T48 T27 T44
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008017 microtubule binding
GO:0019003 GDP binding
GO:0046872 metal ion binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0001822 kidney development
GO:0006892 post-Golgi vesicle-mediated transport
GO:0006893 Golgi to plasma membrane transport
GO:0007224 smoothened signaling pathway
GO:0007264 small GTPase-mediated signal transduction
GO:0015031 protein transport
GO:0042073 intraciliary transport
GO:0042461 photoreceptor cell development
GO:0051301 cell division
GO:0060271 cilium assembly
GO:0061512 protein localization to cilium
GO:1903441 protein localization to ciliary membrane
Cellular Component
GO:0000139 Golgi membrane
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005876 spindle microtubule
GO:0005881 cytoplasmic microtubule
GO:0005929 cilium
GO:0005930 axoneme
GO:0016020 membrane
GO:0030496 midbody
GO:0032391 photoreceptor connecting cilium
GO:0035869 ciliary transition zone
GO:0036064 ciliary basal body
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ok7, PDBe:7ok7, PDBj:7ok7
PDBsum7ok7
PubMed34130453
UniProtQ9WUL7|ARL3_MOUSE ADP-ribosylation factor-like protein 3 (Gene Name=Arl3)

[Back to BioLiP]