Structure of PDB 7oic Chain E

Receptor sequence

>7oicE (length=300) Species: 9606 (Homo sapiens)

SGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGS
FRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKGKMATLSVG
GKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHF
RPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDI
GRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVK
VKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA

3D structure

• PDB: 7oic A distinct assembly pathway of the human 39S late pre-mitoribosome.
• Chain: E
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	W48 V65 D69 M106 K116 V118 S153 R154 F155 R156 K157 Y165 V176 K177 I178 T210 I211 G212 K213 G214 F215 G217 K220 R221 F224 K225 G226 P228 A229 T230 H231 G232 Q233 T234 K235 T236 H237 R238 R239 P240 G241 A242 V243 A244 T245 G246 D247 I248 G249 R250 V251 W252 P253 G254 T255 M257 P258 K260 G262 I264 Y265 R266 Y269 N286 S288 V289 P290 G291 H292 N294 K298 K300 L304 P305	W4 V21 D25 M62 K72 V74 S105 R106 F107 R108 K109 Y117 V128 K129 I130 T162 I163 G164 K165 G166 F167 G169 K172 R173 F176 K177 G178 P180 A181 T182 H183 G184 Q185 T186 K187 T188 H189 R190 R191 P192 G193 A194 V195 A196 T197 G198 D199 I200 G201 R202 V203 W204 P205 G206 T207 M209 P210 K212 G214 I216 Y217 R218 Y221 N238 S240 V241 P242 G243 H244 N246 K250 K252 L256 P257

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oic, PDBe:7oic, PDBj:7oic
• PDBsum: 7oic
• PubMed: 34315873
• UniProt: P09001|RM03_HUMAN Large ribosomal subunit protein uL3m (Gene Name=MRPL3)