Structure of PDB 7oi7 Chain E

Receptor sequence

>7oi7E (length=285) Species: 9606 (Homo sapiens)

SGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGS
FRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMAT
LSVGGKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLY
AAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKTGDIGRVWPGTKMPGKMGN
IYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKN
LPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA

3D structure

• PDB: 7oi7 A distinct assembly pathway of the human 39S late pre-mitoribosome.
• Chain: E
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	W48 W49 K62 V65 D69 K103 M106 V118 V152 S153 R154 F155 R156 K157 I161 Y165 Q174 V176 K177 I178 I211 G212 K213 G214 F215 G217 K220 R221 W222 T245 I248 G249 R250 V251 W252 P253 G254 M257 K260 N263 I264 Y265 R266 E268 Y269 G287 S288 V289 P290 G291 H292 K293 N294 K298 K300 K303 L304 P305	W4 W5 K18 V21 D25 K59 M62 V74 V108 S109 R110 F111 R112 K113 I117 Y121 Q130 V132 K133 I134 I167 G168 K169 G170 F171 G173 K176 R177 W178 T182 I185 G186 R187 V188 W189 P190 G191 M194 K197 N200 I201 Y202 R203 E205 Y206 G224 S225 V226 P227 G228 H229 K230 N231 K235 K237 K240 L241 P242

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oi7, PDBe:7oi7, PDBj:7oi7
• PDBsum: 7oi7
• PubMed: 34315873
• UniProt: P09001|RM03_HUMAN Large ribosomal subunit protein uL3m (Gene Name=MRPL3)