Structure of PDB 7ohs Chain E

Receptor sequence

>7ohsE (length=151) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKRVVYLK
HLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYF
AKEEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDKPHMLK
F

3D structure

PDB

7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

4.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	K8 W9 A16 A17 L18 K19 T21 R22 K23 A24 R26 Q28 K29 G45 R46 R48 N61 F69 K70 G73 P75 R77 R78 N80 R82 Y83 A107 V135 Q157 S160 A161 S162 K166 N167	K2 W3 A10 A11 L12 K13 T15 R16 K17 A18 R20 Q22 K23 G39 R40 R42 N55 F63 K64 G67 P69 R71 R72 N74 R76 Y77 A101 V110 Q132 S135 A136 S137 K141 N142

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
PDBsum	7ohs
PubMed	34813592
UniProt	Q02326\|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]