Structure of PDB 7o5b Chain E

Receptor sequence
>7o5bE (length=164) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
RIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGK
AQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEG
TGVIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAED
VAKLRGKSVEELLG
3D structure
PDB7o5b Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp.
ChainE
Resolution3.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E V21 A22 K23 V24 V25 G27 R29 R30 K52 K69 F89 A91 S100 I106 A107 R112 L124 S125 K126 S127 L128 S130 N131 T132 N135 V19 A20 K21 V22 V23 G25 R27 R28 K50 K67 F87 A89 S98 I104 A105 R110 L122 S123 K124 S125 L126 S128 N129 T130 N133
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o5b, PDBe:7o5b, PDBj:7o5b
PDBsum7o5b
PubMed35217658
UniProtP21467|RS5_BACSU Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]