Structure of PDB 7nvo Chain E

Receptor sequence
>7nvoE (length=249) Species: 9606 (Homo sapiens) [Search protein sequence]
SRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGA
TILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLD
RGIHPIRIADGYEQAARVAIEHLDKISDSRVVYGGGAAEISCALAVSQEA
DKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNP
ALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKP
3D structure
PDB7nvo Snapshots of actin and tubulin folding inside the TRiC chaperonin.
ChainE
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP E L52 P54 N72 D104 G105 T106 T107 G422 V506 E508 L27 P29 N47 D79 G80 T81 T82 G135 V219 E221
Gene Ontology
Molecular Function
GO:0003730 mRNA 3'-UTR binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0031681 G-protein beta-subunit binding
GO:0044183 protein folding chaperone
GO:0048027 mRNA 5'-UTR binding
GO:0048487 beta-tubulin binding
GO:0051082 unfolded protein binding
GO:0140662 ATP-dependent protein folding chaperone
Biological Process
GO:0006457 protein folding
GO:0007339 binding of sperm to zona pellucida
GO:0009615 response to virus
GO:0032212 positive regulation of telomere maintenance via telomerase
GO:0050821 protein stabilization
GO:0051086 chaperone mediated protein folding independent of cofactor
GO:0061077 chaperone-mediated protein folding
GO:1904871 positive regulation of protein localization to Cajal body
GO:1904874 positive regulation of telomerase RNA localization to Cajal body
Cellular Component
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005832 chaperonin-containing T-complex
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0044297 cell body
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nvo, PDBe:7nvo, PDBj:7nvo
PDBsum7nvo
PubMed35449234
UniProtP48643|TCPE_HUMAN T-complex protein 1 subunit epsilon (Gene Name=CCT5)

[Back to BioLiP]