Structure of PDB 7msz Chain E

Receptor sequence

>7mszE (length=207) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]

LKIDVKTPAGKVDGAIELPAELFDVPANIALMHQVVTAQRAAARQGTHST
KTRGEVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDYSQRT
PKKMIAAALRGALSDRARNGRIHAITELVEGQNPSTKSARAFLASLTERK
QVLVVIGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDVVFSVEALN
AYIAANT

3D structure

PDB

7msz Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	H41 Q42 Q47 R48 A51 R52 Q53 T55 H56 S57 T60 R61 G62 S65 R69 K70 Q74 K75 G78 R79 R81 Q82 Q89 F90 T91 G92 V96 H97 P99 R102 Q106 R107 K110 K111 M112 I113 P142 S143 T144 R148 R166 K173 R176 N177 L178 H182 A185 Q188 N190 Y192 D193	H33 Q34 Q39 R40 A43 R44 Q45 T47 H48 S49 T52 R53 G54 S57 R61 K62 Q66 K67 G70 R71 R73 Q74 Q81 F82 T83 G84 V88 H89 P91 R94 Q98 R99 K102 K103 M104 I105 P134 S135 T136 R140 R158 K165 R168 N169 L170 H174 A177 Q180 N182 Y184 D185

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7msz, PDBe:7msz, PDBj:7msz
PDBsum	7msz
PubMed	35064151
UniProt	P9WH85\|RL4_MYCTU Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]