Structure of PDB 7m4x Chain E

Receptor sequence

>7m4xE (length=200) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

MNLKTVSGSAVELSEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRAD
VSGGGKKPFRQKGTGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMY
RGAMQCILAELVRQDRLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTD
AVDENLYLAARNLPHVDVVDATAIDPVSLIAFDKVVMSVAAAKKIEVELG

3D structure

PDB

7m4x Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	N23 H28 Y34 L35 R39 Q40 T42 R43 A44 H45 K46 R48 A49 G53 K56 K57 Q61 K62 G63 G65 R66 A67 R68 G70 R73 S74 I76 W77 V78 G79 K82 F84 W91 K94 N96 K98 M99 Y100 P128 T130 K131 L158 R161 N162 L163 P164	N23 H28 Y34 L35 R39 Q40 T42 R43 A44 H45 K46 R48 A49 G53 K56 K57 Q61 K62 G63 G65 R66 A67 R68 G70 R73 S74 I76 W77 V78 G79 K82 F84 W91 K94 N96 K98 M99 Y100 P128 T130 K131 L158 R161 N162 L163 P164

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7m4x, PDBe:7m4x, PDBj:7m4x
PDBsum	7m4x
PubMed	34044590
UniProt	B7IA38\|RL4_ACIB5 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]