Structure of PDB 7kbf Chain E

Receptor sequence
>7kbfE (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB7kbf Structural features of nucleosomes in interphase and metaphase chromosomes.
ChainE
Resolution4.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 P43 G44 V46 R49 R63 K64 L65 R69 R83 H2 R3 Y4 P6 G7 V9 R12 R26 K27 L28 R32 R46
BS02 dna E R40 R42 T45 R72 R83 F84 R116 R3 R5 T8 R35 R46 F47 R79
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7kbf, PDBe:7kbf, PDBj:7kbf
PDBsum7kbf
PubMed34478647
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]