Structure of PDB 7k7h Chain E |
>7k7hE (length=114) Species: 220341 (Salmonella enterica subsp. enterica serovar Typhi str. CT18) [Search protein sequence] |
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVS KQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALV GLSSCSATQCFGPK |
|
PDB | 7k7h The structural basis of Salmonella A 2 B 5 toxin neutralization by antibodies targeting the glycan-receptor binding subunits. |
Chain | E |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
E |
D87 S94 |
D64 S71 |
|
|
|
|