Structure of PDB 7k78 Chain E

Receptor sequence

>7k78E (length=98) Species: 4932 (Saccharomyces cerevisiae)

YTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSM
AIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI

3D structure

• PDB: 7k78 Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
• Chain: E
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	P134 L137 I156 P157	P3 L6 I25 P26
BS02	dna	E	I211 T212	I80 T81

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 15:26:44 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7k78', asym_id = 'E', title = 'Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7k78', asym_id='E', title='Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000786,0003677,0030527,0046982', uniprot = '', pdbid = '7k78', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000786,0003677,0030527,0046982', uniprot='', pdbid='7k78', asym_id='E')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>