Structure of PDB 7k6p Chain E

Receptor sequence
>7k6pE (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFMTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB7k6p Regulation of the Dot1 histone H3K79 methyltransferase by histone H4K16 acetylation.
ChainE
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R40 Y41 G44 V46 A47 R49 K64 L65 P66 R69 R1 Y2 G5 V7 A8 R10 K25 L26 P27 R30
BS02 dna E Y41 R42 P43 T45 R72 R83 Q85 R116 V117 T118 M120 Y2 R3 P4 T6 R33 R44 Q46 R77 V78 T79 M81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7k6p, PDBe:7k6p, PDBj:7k6p
PDBsum7k6p
PubMed33479126
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]