Structure of PDB 7jre Chain E |
>7jreE (length=142) Species: 42789 (enterovirus D68) [Search protein sequence] |
GPGFGGVFVGSFKIINYHLATIEERQSAIYVDWQSDVLVTPIAAHGRHQI ARCKCNTGVYYCRHRDKSYPVCFEGPGIQWIEQNEYYPARYQTNVLLAAG PAEAGDAGGLLVCPHGVIGLLTAGGGGIVAFTDIRNLLWLDT |
|
PDB | 7jre Crystal structure of EV-D68 2A protease C107A mutant |
Chain | E |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
C53 C55 C113 H115 |
C53 C55 C113 H115 |
|
|
|
|