Structure of PDB 7f3j Chain E

Receptor sequence

>7f3jE (length=90) Species: 9606 (Homo sapiens)

PVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRS
VGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNR

3D structure

• PDB: 7f3j Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P1
• Chain: E
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	K99 W100 F101 N102 V103 R104 Y107 F109 D118 F120 K153 E156 Y173	K12 W13 F14 N15 V16 R17 Y20 F22 D31 F33 K66 E69 Y86

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

External links

• PDB: RCSB:7f3j, PDBe:7f3j, PDBj:7f3j
• PDBsum: 7f3j
• UniProt: Q9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)