Structure of PDB 7ekt Chain E

Receptor sequence

>7ektE (length=396) Species: 9606 (Homo sapiens)

GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVL
TTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERF
DATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWS
YGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTF
TVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSL
TVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDP
DGGKMPKWTRVILLNWCAWFLRMKRDLAKILEEVRYIANRFRCQDESEAV
CSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

3D structure

• PDB: 7ekt Structural basis of human alpha 7 nicotinic acetylcholine receptor activation.
• Chain: E
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	I33	E	W171 Y210 C212 Y217	W149 Y188 C190 Y195	BindingDB: Ki=9.98nM,EC50=250nM
BS02	I34	E	M276 V290 A298	M254 V268 A276	BindingDB: EC50=3800nM
BS03	I33	E	S56 L57 S58 W77 L78 Q79 L141 D186	S34 L35 S36 W55 L56 Q57 L119 D164	BindingDB: Ki=9.98nM,EC50=250nM
BS04	I34	E	L235 N236 P240 F275	L213 N214 P218 F253	BindingDB: EC50=3800nM
BS05	CLR	E	W330 T331 L470 C471 A474	W308 T309 L364 C365 A368

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0022848 acetylcholine-gated monoatomic cation-selective channel activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0034220 monoatomic ion transmembrane transport

Cellular Component

• GO:0016020 membrane
• GO:0045211 postsynaptic membrane

External links

• PDB: RCSB:7ekt, PDBe:7ekt, PDBj:7ekt
• PDBsum: 7ekt
• PubMed: 33958730
• UniProt: P36544|ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 (Gene Name=CHRNA7)