Structure of PDB 7e9c Chain E

Receptor sequence

>7e9cE (length=87) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

VALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQES
VEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRG

3D structure

PDB

7e9c Nucleosome binding relinquishes the association of the BAH domain of Orc1 with Sir1

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	E	R83 Q85 S86 V117 T118	R38 Q40 S41 V72 T73
BS02	dna	E	V46 R63 P66 R69	V1 R18 P21 R24

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0008823	cupric reductase (NADH) activity
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription
GO:0006878	intracellular copper ion homeostasis
GO:0009060	aerobic respiration
GO:0009303	rRNA transcription
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0043935	sexual sporulation resulting in formation of a cellular spore
GO:0045943	positive regulation of transcription by RNA polymerase I
GO:0070911	global genome nucleotide-excision repair

	Cellular Component
GO:0000500	RNA polymerase I upstream activating factor complex
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0031298	replication fork protection complex
GO:0032991	protein-containing complex
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:7e9c, PDBe:7e9c, PDBj:7e9c
PDBsum	7e9c
PubMed
UniProt	P61830\|H3_YEAST Histone H3 (Gene Name=HHT1)