Structure of PDB 7c53 Chain E

Receptor sequence
>7c53E (length=93) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence]
VTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKE
3D structure
PDB7c53 Structural and functional basis for pan-CoV fusion inhibitors against SARS-CoV-2 and its variants with preclinical evaluation.
ChainE
Resolution2.278 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA E D1032 L1033 E1035 D90 L91 E93
Gene Ontology
Biological Process
GO:0019064 fusion of virus membrane with host plasma membrane
GO:0039654 fusion of virus membrane with host endosome membrane
GO:0046813 receptor-mediated virion attachment to host cell
GO:0075509 endocytosis involved in viral entry into host cell
Cellular Component
GO:0016020 membrane
GO:0019031 viral envelope
GO:0055036 virion membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c53, PDBe:7c53, PDBj:7c53
PDBsum7c53
PubMed34326308
UniProtP0DTC2|SPIKE_SARS2 Spike glycoprotein (Gene Name=S)

[Back to BioLiP]