Structure of PDB 7bv4 Chain E

Receptor sequence

>7bv4E (length=117) Species: 9606 (Homo sapiens) [Search protein sequence]

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
EDFFLYIAYSDESVYGL

3D structure

PDB

7bv4 Decoding three distinct states of the Syntaxin17 SNARE motif in mediating autophagosome-lysosome fusion.

Chain

Resolution

2.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	P10 E12 S16	P10 E12 S16
BS02	peptide	E	E17 R28 P30 K46 K48 Y49 L50 L63 K66 R67 F104	E17 R28 P30 K46 K48 Y49 L50 L63 K66 R67 F104

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0008429	phosphatidylethanolamine binding
GO:0031625	ubiquitin protein ligase binding
GO:0048487	beta-tubulin binding
GO:0050811	GABA receptor binding

	Biological Process
GO:0000045	autophagosome assembly
GO:0000226	microtubule cytoskeleton organization
GO:0000422	autophagy of mitochondrion
GO:0006605	protein targeting
GO:0006914	autophagy
GO:0006915	apoptotic process
GO:0006995	cellular response to nitrogen starvation
GO:0007268	chemical synaptic transmission
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031	protein transport
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020	regulation of Rac protein signal transduction
GO:0097352	autophagosome maturation
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524	positive regulation of protein K48-linked ubiquitination

	Cellular Component
GO:0000139	Golgi membrane
GO:0000421	autophagosome membrane
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005776	autophagosome
GO:0005790	smooth endoplasmic reticulum
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005875	microtubule associated complex
GO:0005886	plasma membrane
GO:0005930	axoneme
GO:0012505	endomembrane system
GO:0015629	actin cytoskeleton
GO:0016020	membrane
GO:0031410	cytoplasmic vesicle
GO:0097225	sperm midpiece
GO:0098982	GABA-ergic synapse

External links

PDB	RCSB:7bv4, PDBe:7bv4, PDBj:7bv4
PDBsum	7bv4
PubMed	32817423
UniProt	O95166\|GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein (Gene Name=GABARAP)