Structure of PDB 7as9 Chain E

Receptor sequence

>7as9E (length=272) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

AIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTV
RHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEK
RYILAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKG
GQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHE
LINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPMSPWG
KPTLGFKTRKKKNKSDKFIVRR

3D structure

PDB

7as9 Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	K7 P8 T9 S10 N11 G12 R13 R14 F21 K31 S32 P36 H38 K39 K40 G42 R43 N44 N45 Q46 G47 K48 L49 T50 R52 H53 Q54 G55 G56 H58 K59 Q61 Y62 R63 K68 I74 Y83 P85 R87 A97 D98 G99 K101 K147 P148 G149 K150 Q153 L154 V155 R156 S157 A158 G159 T160 K170 Y171 L176 N177 S178 E180 R182 E198 H200 E201 N204 I205 G206 K207 A208 G209 R210 R212 W213 R217 P218 T219 V220 R221 S223 V224 M225 N226 P227 N228 D229 H232 G234 G235 E236 G237 R238 A239 P240 I241 G242 R243 K244 W250 T254 L255 G256 F257 K258 T259 R260 K262 K263 S266 K268	K6 P7 T8 S9 N10 G11 R12 R13 F20 K30 S31 P35 H37 K38 K39 G41 R42 N43 N44 Q45 G46 K47 L48 T49 R51 H52 Q53 G54 G55 H57 K58 Q60 Y61 R62 K67 I73 Y82 P84 R86 A96 D97 G98 K100 K146 P147 G148 K149 Q152 L153 V154 R155 S156 A157 G158 T159 K169 Y170 L175 N176 S177 E179 R181 E197 H199 E200 N203 I204 G205 K206 A207 G208 R209 R211 W212 R216 P217 T218 V219 R220 S222 V223 M224 N225 P226 N227 D228 H231 G233 G234 E235 G236 R237 A238 P239 I240 G241 R242 K243 W249 T253 L254 G255 F256 K257 T258 R259 K261 K262 S265 K267

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7as9, PDBe:7as9, PDBj:7as9
PDBsum	7as9
PubMed	33259810
UniProt	P42919\|RL2_BACSU Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]