Structure of PDB 7aqd Chain E

Receptor sequence

>7aqdE (length=205) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

PKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGTHKV
KNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKL
PKKVRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKK
ALIVTADANEAVALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEK
VEEVL

3D structure

PDB

7aqd Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	L38 M39 Q40 R41 S43 L44 R45 Q46 T48 H49 K50 V51 K52 N53 R54 S55 V57 R58 G60 R62 K63 Q67 K68 G69 G71 R72 A73 R74 Q75 G76 R79 P81 Q82 W83 R84 V88 F90 G91 P92 R95 Y99 K103 K104 V105 R106 R107 A134 K135 T136 K137 K151 L165 R168 N169 G180	L37 M38 Q39 R40 S42 L43 R44 Q45 T47 H48 K49 V50 K51 N52 R53 S54 V56 R57 G59 R61 K62 Q66 K67 G68 G70 R71 A72 R73 Q74 G75 R78 P80 Q81 W82 R83 V87 F89 G90 P91 R94 Y98 K102 K103 V104 R105 R106 A133 K134 T135 K136 K150 L164 R167 N168 G179

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7aqd, PDBe:7aqd, PDBj:7aqd
PDBsum	7aqd
PubMed	33259811
UniProt	P42921\|RL4_BACSU Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]