Structure of PDB 7aln Chain E

Receptor sequence

>7alnE (length=370) Species: 36329 (Plasmodium falciparum 3D7)

VQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPGIMVGMEEKDAFV
GDEAQTKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVL
LTEAPLNPKGNRERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLD
SGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSA
EKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKSYELPDGNIITVGNER
FRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTT
MYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQ
MWITKEEYDESGPSIVHRKC

3D structure

• PDB: 7aln The actomyosin interface contains an evolutionary conserved core and an ancillary interface involved in specificity.
• Chain: E
• Resolution: 3.77 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	9UE	E	H74 I76 P113 R178 D180	H69 I71 P108 R173 D175
BS02	ADP	E	G14 S15 N17 G157 D158 R211 K214 E215 G303 K337	G9 S10 N12 G152 D153 R206 K209 E210 G298 K332
BS03	9UE	E	G198 Y199 G200 F201 N247	G193 Y194 G195 F196 N242

Gene Ontology

Molecular Function

• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0007010 cytoskeleton organization
• GO:0009665 plastid inheritance
• GO:0020014 schizogony
• GO:0070360 symbiont-mediated actin polymerization-dependent cell-to-cell migration in host
• GO:0085017 entry into host cell by a symbiont-containing vacuole

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005884 actin filament
• GO:0015629 actin cytoskeleton

External links

• PDB: RCSB:7aln, PDBe:7aln, PDBj:7aln
• PDBsum: 7aln
• PubMed: 33767187
• UniProt: Q8I4X0|ACT1_PLAF7 Actin-1 (Gene Name=ACT1)