Structure of PDB 6z6p Chain E

Receptor sequence
>6z6pE (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB6z6p Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
ChainE
Resolution4.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 P43 V46 R49 K64 L65 P66 R69 R83 H1 R2 Y3 P5 V8 R11 K26 L27 P28 R31 R45
BS02 dna E H39 R40 Y41 R42 R63 R72 R83 F84 R116 T118 H1 R2 Y3 R4 R25 R34 R45 F46 R78 T80
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6z6p, PDBe:6z6p, PDBj:6z6p
PDBsum6z6p
PubMed33523989
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]