Structure of PDB 6ywy Chain E

Receptor sequence

>6ywyE (length=309) Species: 5141 (Neurospora crassa)

IPDLAELETRSALDAPIPSEEDKKEFRPWKRAADRKARLPSSRYQYHPPK
YNRGPLHPIQSPPSSDPIARDFVPGPFNMPRLKETFRTVMASDLMTLAYI
HTPPGTPKKEPTERLRAWEGDSPYFANRARRAPRGAPELPIRERDISFRN
IPEIKEITVSTFVPLGLKNPDLLIVARAVLLAMTGTMPEMTRSKNNVVQW
QLQANKPAGCKTTIYGNAAWEFMDRLIHLVLPRIKDWKGVPASTGDGSGN
VQFGLNPEDVQLFPEVECNYDMYPAKMIPGCHIAIKTTATSDRQAKLLLQ
SLGVPFYSN

3D structure

• PDB: 6ywy Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
• Chain: E
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	K66 F69 R70 P71 W72 R74 A76 R78 K79 R81 L82 S84 R86 Y87 Q88 Y89 H90 P91 P92 K93 P98 L99 H100 I102 S107 S108 F115 V116 P147 R157 L158 R159 W161 E162 P166 Y167 F168 N170 R171 R173 R174 A175 P176 R177 G178 P180 E181 L182 I184 R185 F191 R192 S203 F205 P207 I217 R220 M233 R235 K237 N238 Q242 W243 L245 K254 Y258 S286 T287 G288 D289 S291 Q295 L298 N299 G323 H325 K329 R336	K23 F26 R27 P28 W29 R31 A33 R35 K36 R38 L39 S41 R43 Y44 Q45 Y46 H47 P48 P49 K50 P55 L56 H57 I59 S64 S65 F72 V73 P104 R114 L115 R116 W118 E119 P123 Y124 F125 N127 R128 R130 R131 A132 P133 R134 G135 P137 E138 L139 I141 R142 F148 R149 S160 F162 P164 I174 R177 M190 R192 K194 N195 Q199 W200 L202 K211 Y215 S243 T244 G245 D246 S248 Q252 L255 N256 G280 H282 K286 R293
BS02	rna	E	D314 A318	D271 A275
BS03	NAD	E	P119 M122 K126 R130 N260	P76 M79 K83 R87 N217

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ywy, PDBe:6ywy, PDBj:6ywy
• PDBsum: 6ywy
• PubMed: 33056988
• UniProt: Q96U12