Structure of PDB 6yms Chain E

Receptor sequence

>6ymsE (length=316) Species: 1422 (Geobacillus stearothermophilus)

ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTL
PGSLWADADNQFFASYDAPAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAI
RSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTD
YTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGD
SLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTH
YGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTS
QEVASVKQAFDAVGVK

3D structure

• PDB: 6yms Structural and Kinetic Evaluation of Phosphoramidate Inhibitors on Thermolysin
• Chain: E
• Resolution: 1.32 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.27: thermolysin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	E	D138 E177 D185 E187 E190	D138 E177 D185 E187 E190
BS02	CA	E	D57 D59 Q61	D57 D59 Q61
BS03	CA	E	E177 N183 D185 E190	E177 N183 D185 E190
BS04	CA	E	Y193 T194 I197 D200	Y193 T194 I197 D200
BS05	ZN	E	H142 H146 E166	H142 H146 E166
BS06	OZH	E	N112 A113 L133 V139 H142 E143 H146 Y157 E166 L202 R203 H231	N112 A113 L133 V139 H142 E143 H146 Y157 E166 L202 R203 H231

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:6yms, PDBe:6yms, PDBj:6yms
• PDBsum: 6yms
• UniProt: P43133|THER_GEOSE Thermolysin (Gene Name=nprS)