Structure of PDB 6xir Chain E

Receptor sequence

>6xirE (length=156) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDK
PHMLKF

3D structure

PDB

6xir Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	S2 A3 K5 W9 A17 L18 K19 K20 T21 R22 K23 A24 R26 Q28 K29 G45 R46 R48 D60 N61 T62 F69 K70 V71 N72 G73 P75 R77 R78 N80 R82 Y83 K108 V135 N167	S1 A2 K4 W8 A16 L17 K18 K19 T20 R21 K22 A23 R25 Q27 K28 G44 R45 R47 D59 N60 T61 F68 K69 V70 N71 G72 P74 R76 R77 N79 R81 Y82 K107 V115 N147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xir, PDBe:6xir, PDBj:6xir
PDBsum	6xir
PubMed	32855298
UniProt	Q02326\|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]