Structure of PDB 6xdq Chain E

Receptor sequence

>6xdqE (length=86) Species: 562 (Escherichia coli) [Search protein sequence]

ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

PDB

6xdq Structural basis of transcription-translation coupling.

Chain

Resolution

3.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	A2 N3 I4 K5 S6 A7 K9 R10 Q13 S14 A17 R18 H20 N21 S23 R25 S26 M27 R29 T30 K33 K34 Y36 P56 D59 R60 K64 H68 K69 N70 K71 A73 R74 K76 N78 T80	A1 N2 I3 K4 S5 A6 K8 R9 Q12 S13 A16 R17 H19 N20 S22 R24 S25 M26 R28 T29 K32 K33 Y35 P55 D58 R59 K63 H67 K68 N69 K70 A72 R73 K75 N77 T79

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008073	ornithine decarboxylase inhibitor activity
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6xdq, PDBe:6xdq, PDBj:6xdq
PDBsum	6xdq
PubMed	32820061
UniProt	P0A7U7\|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)