Structure of PDB 6wfg Chain E

Receptor sequence
>6wfgE (length=151) Species: 9606 (Homo sapiens) [Search protein sequence]
SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFND
IAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKD
GTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKN
L
3D structure
PDB6wfg Characterization of SpecificN-alpha-Acetyltransferase 50 (Naa50) Inhibitors Identified Using a DNA Encoded Library.
ChainE
Resolution2.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 COA E F27 L77 G78 C79 R84 R85 G87 G89 T90 N117 S119 D122 F123 Y124 K126 F24 L74 G75 C76 R81 R82 G84 G86 T87 N114 S116 D119 F120 Y121 K123 BindingDB: Kd=156nM
BS02 U3V E F27 Y31 R62 D64 Y73 M75 Y110 H112 Y138 Y139 F24 Y28 R59 D61 Y70 M72 Y107 H109 Y135 Y136 MOAD: ic50=2700nM
BindingDB: Kd=1010nM,IC50=2000nM
Gene Ontology
Molecular Function
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0005515 protein binding
GO:0010485 histone H4 acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006474 N-terminal protein amino acid acetylation
GO:0007064 mitotic sister chromatid cohesion
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0071962 mitotic sister chromatid cohesion, centromeric
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031415 NatA complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wfg, PDBe:6wfg, PDBj:6wfg
PDBsum6wfg
PubMed32550998
UniProtQ9GZZ1|NAA50_HUMAN N-alpha-acetyltransferase 50 (Gene Name=NAA50)

[Back to BioLiP]