Structure of PDB 6wa0 Chain E

Receptor sequence
>6wa0E (length=31) Species: 32630 (synthetic construct) [Search protein sequence]
EPETALLVAFVAYYTALIALIFAILATRRLM
3D structure
PDB6wa0 De novo designed receptor transmembrane domains enhance CAR-T cytotoxicity and attenuate cytokine release
ChainE
Resolution3.484 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide E A5 V8 V11 A12 T15 A19 F22 A26 R29 A5 V8 V11 A12 T15 A19 F22 A26 R29
BS02 peptide E L20 L30 L20 L30
External links