Structure of PDB 6w7m Chain E

Receptor sequence

>6w7mE (length=156) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
SVEEIL

3D structure

PDB

6w7m Alternative conformations and motions adopted by 30S ribosomal subunits visualized by cryo-electron microscopy.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	V18 N19 R20 V21 S22 K23 T24 V25 R29 Y50 V56 K62 E65 R69 H89 T90 A99 S100 T103 A107 R112 L124 K126 Y128 S130 T131 N132 I134 N135 R138	V9 N10 R11 V12 S13 K14 T15 V16 R20 Y41 V47 K53 E56 R60 H80 T81 A90 S91 T94 A98 R103 L115 K117 Y119 S121 T122 N123 I125 N126 R129

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6w7m, PDBe:6w7m, PDBj:6w7m
PDBsum	6w7m
PubMed	32989043
UniProt	P0A7W1\|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]