Structure of PDB 6w6k Chain E

Receptor sequence
>6w6kE (length=149) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRG
3D structure
PDB6w6k Alternative conformations and motions adopted by 30S ribosomal subunits visualized by cryo-electron microscopy.
ChainE
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E V20 S21 T23 K25 R28 Y49 K51 K61 T89 F94 A98 S99 A106 G107 L123 A124 K125 A126 S129 T130 N131 I133 N134 R137 V12 S13 T15 K17 R20 Y41 K43 K53 T81 F86 A90 S91 A98 G99 L115 A116 K117 A118 S121 T122 N123 I125 N126 R129
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6k, PDBe:6w6k, PDBj:6w6k
PDBsum6w6k
PubMed32989043
UniProtP0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]