Structure of PDB 6w1t Chain E

Receptor sequence
>6w1tE (length=82) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRP
DSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
3D structure
PDB6w1t Untangling the sequence of events during the S2→ S3transition in photosystem II and implications for the water oxidation mechanism.
ChainE
Resolution2.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC E R18 Y19 I22 H23 T26 I27 L30 R16 Y17 I20 H21 T24 I25 L28
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w1t, PDBe:6w1t, PDBj:6w1t
PDBsum6w1t
PubMed32434915
UniProtQ8DIP0|PSBE_THEVB Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]