Structure of PDB 6vyp Chain E

Receptor sequence
>6vypE (length=110) Species: 8355 (Xenopus laevis) [Search protein sequence]
ARTMQTARKSTGGKAPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVR
EIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPK
DIQLARRIRG
3D structure
PDB6vyp Crystal Structure of the LSD1/CoREST Histone Demethylase Bound to Its Nucleosome Substrate.
ChainE
Resolution4.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E A15 H39 Y41 G44 V46 R49 K64 L65 P66 R69 R83 A15 H17 Y19 G22 V24 R27 K42 L43 P44 R47 R61
BS02 dna E R42 T45 R72 R83 F84 Q85 R116 V117 T118 M120 R20 T23 R50 R61 F62 Q63 R94 V95 T96 M98
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6vyp, PDBe:6vyp, PDBj:6vyp
PDBsum6vyp
PubMed32396821
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]