Structure of PDB 6v39 Chain E

Receptor sequence

>6v39E (length=186) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

SEVAFGREFNEALVHQVVTAYLAGGRQGTRAHKSRADVSGGGKKPFRQKG
TGRARAGSIRSPIWVGGGKTFAARPQDWSQKVNRKMYRGAMQCILAELVR
QDRLVLVEEFAVAAPKTKELLAKLNDLNAARALIVTDAVDENLYLAARNL
PHVDVVDATAIDPVSLIAFDKVVMSVAAAKKIEVEL

3D structure

PDB

6v39 Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.

Chain

Resolution

3.04 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	N23 H28 Q29 Y34 R39 Q40 T42 R43 A44 H45 K46 R48 A49 V51 G53 K56 K57 Q61 K62 G63 R66 A67 R68 G70 I76 V78 G79 K82 F84 Q89 K94 N96 K98 R101 P128 K129 T130 K131 L158 R161 N162	N10 H15 Q16 Y21 R26 Q27 T29 R30 A31 H32 K33 R35 A36 V38 G40 K43 K44 Q48 K49 G50 R53 A54 R55 G57 I63 V65 G66 K69 F71 Q76 K81 N83 K85 R88 P115 K116 T117 K118 L145 R148 N149

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6v39, PDBe:6v39, PDBj:6v39
PDBsum	6v39
PubMed	31964740
UniProt	B7IA38\|RL4_ACIB5 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]