Structure of PDB 6uca Chain E

Receptor sequence

>6ucaE (length=402) Species: 9606 (Homo sapiens)

VLPLDPAVPAPLCPHGPTLLFVKTRRFYACSACRDRKDCNFFQWEDEKLS
GARLAAREAHNRRCQPPLSRTQCVERYLKFIELPLTQRKFCQTCQQLLLP
DDWGQHSEHQVLGNVSITQLRRPSQLLYPLENAATNAQYLFADRSCQFLV
DLLSALGFRRVLCVGTPRLHELIKLTASGDKKSNIKSLLLDIDFRYSQFY
MEDSFCHYNMFNHHFFDGKTALEVCRAFLQEDKGEGIIMVTDPPFGGLVE
PLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQML
DYQVDYDNHALYKHGRKQSPVRIFTNIPPNKIILPTEEGYRFCSPCQRYV
SLENQHCELCNSCTSKDGRKWNHCFLCKKCVKPSWIHCSICNHCAVPDHS
CE

3D structure

• PDB: 6uca Structure and regulation of ZCCHC4 in m6A-methylation of 28S rRNA.
• Chain: E
• Resolution: 3.103 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	E	N170 Q172 Y173 L174 F175 G199 T200 P201 R202 D225 I226 Y242 N243 M244 F245 D276	N136 Q138 Y139 L140 F141 G165 T166 P167 R168 D191 I192 Y208 N209 M210 F211 D242
BS02	ZN	E	C40 H42 C64 C73	C13 H15 C30 C39
BS03	ZN	E	C125 C128 H140 H143	C91 C94 H106 H109
BS04	ZN	E	C380 H393 C400	C343 H356 C363
BS05	ZN	E	C394 H410 C417	C357 H373 C380
BS06	ZN	E	C411 C414 H424	C374 C377 H387
BS07	ZN	E	C425 C428 H436 C438	C388 C391 H399 C401

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008168 methyltransferase activity
• GO:0008270 zinc ion binding
• GO:0008988 rRNA (adenine-N6-)-methyltransferase activity

Biological Process

• GO:0031167 rRNA methylation
• GO:0032259 methylation

External links

• PDB: RCSB:6uca, PDBe:6uca, PDBj:6uca
• PDBsum: 6uca
• PubMed: 31695039
• UniProt: Q9H5U6|ZCHC4_HUMAN rRNA N6-adenosine-methyltransferase ZCCHC4 (Gene Name=ZCCHC4)