Structure of PDB 6ua4 Chain E

Receptor sequence

>6ua4E (length=488) Species: 9606 (Homo sapiens)

SYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKY
EQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISS
RDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRL
DLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQA
KNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKK
YRGMGSLDAMIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSL
TQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

3D structure

• PDB: 6ua4 Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.
• Chain: E
• Resolution: 3.65 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	E	K58 T60 R355 R356 T477 R480	K48 T50 R345 R346 T451 R454
BS02	GTP	E	K109 P118 F139 C140 G141 A223 T225 D226	K99 P108 F129 C130 G131 A213 T215 D216
BS03	GTP	E	L194 K195 N198 D226 L227 N230 K242	L184 K185 N188 D216 L217 N220 K232
BS04	ATP	E	S159 S160 R161 D162 T180 L185 V186 K206 K208	S149 S150 R151 D152 T170 L175 V176 K196 K198
BS05	IMP	E	M70 G328 S329 I330 C331 D364 G365 G387 S388 Y411 G413 M414 G415 Q441	M60 G318 S319 I320 C321 D354 G355 G377 S378 Y401 G403 M404 G405 Q415
BS06	NAD	E	T252 H253 D274 S275 S276 F282 N303 G415 Q441	T242 H243 D264 S265 S266 F272 N293 G405 Q415

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003824 catalytic activity
• GO:0003938 IMP dehydrogenase activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006177 GMP biosynthetic process
• GO:0006183 GTP biosynthetic process
• GO:0007623 circadian rhythm
• GO:0046651 lymphocyte proliferation
• GO:0071353 cellular response to interleukin-4
• GO:0097294 'de novo' XMP biosynthetic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005778 peroxisomal membrane
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0034774 secretory granule lumen
• GO:0070062 extracellular exosome
• GO:1904813 ficolin-1-rich granule lumen

External links

• PDB: RCSB:6ua4, PDBe:6ua4, PDBj:6ua4
• PDBsum: 6ua4
• PubMed: 31999252
• UniProt: P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 (Gene Name=IMPDH2)