Structure of PDB 6tqn Chain E

Receptor sequence
>6tqnE (length=98) Species: 562 (Escherichia coli) [Search protein sequence]
QNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTV
LISPHVNDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
3D structure
PDB6tqn Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
ChainE
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E D14 H15 D13 H14
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001072 transcription antitermination factor activity, RNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0008023 transcription elongation factor complex
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tqn, PDBe:6tqn, PDBj:6tqn
PDBsum6tqn
PubMed32871103
UniProtP0A7R5|RS10_ECOLI Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]