Structure of PDB 6t83 Chain E

Receptor sequence

>6t83E (length=159) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

PDB

6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	G2 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 R17 H22 G23 K35 K43 Q49 K50 G51 H54 K55 G59 T61 T68 K69 S70 S71 L85 K87 R88 R92 K100 R102 F105 R108 V109 N112 R116 K120 V126 Q127 K129 R130 Q131	G1 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 R16 H21 G22 K34 K42 Q48 K49 G50 H53 K54 G58 T60 T67 K68 S69 S70 L84 K86 R87 R91 K99 R101 F104 R107 V108 N111 R115 K119 V125 Q126 K128 R129 Q130
BS02	rna	E	R20 H26 L27 S28	R19 H25 L26 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t83, PDBe:6t83, PDBj:6t83
PDBsum	6t83
PubMed	31858614
UniProt	Q02753\|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]