Structure of PDB 6sj6 Chain E

Receptor sequence

>6sj6E (length=216) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

TKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQV
GFEDKKAYKKDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEV
GQEVSVDTFVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMSHGSHFHRAP
GSVGMASDASRVFKGQKMPGRMGGNTVTVQNLEVVQVDTENKVILVKGNV
PGPKKGLVEIRTSIKK

3D structure

PDB

6sj6 Mechanism of ribosome shutdown by RsfS in Staphylococcus aureus revealed by integrative structural biology approach.

Chain

Resolution

3.23 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	Y46 Q50 K60 K64 S65 K67 K71 P72 G75 R86 R89 E90 R92 K123 G124 K125 G126 F127 G129 K132 Q136 S137 R138 S142 H143 G144 H146 F147 H148 R149 S153 M156 S158 D159 A160 S161 R162 V163 K165 M169 R172 T177 Q181 N200 P202 K216 K217	Y45 Q49 K59 K63 S64 K66 K70 P71 G74 R85 R88 E89 R91 K122 G123 K124 G125 F126 G128 K131 Q135 S136 R137 S141 H142 G143 H145 F146 H147 R148 S152 M155 S157 D158 A159 S160 R161 V162 K164 M168 R171 T176 Q180 N199 P201 K215 K216

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6sj6, PDBe:6sj6, PDBj:6sj6
PDBsum	6sj6
PubMed	32245971
UniProt	Q2FW06\|RL3_STAA8 Large ribosomal subunit protein uL3 (Gene Name=rplC)

[Back to BioLiP]