Structure of PDB 6sev Chain E |
>6sevE (length=150) Species: 1642 (Listeria innocua) [Search protein sequence] |
VDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQ MDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTL ELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE |
|
PDB | 6sev Metal Positions and Translocation Pathways of the Dodecameric Ferritin-like Protein Dps. |
Chain | E |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
E |
D59 E63 |
D52 E56 |
|
|
|
|