Structure of PDB 6rkc Chain E

Receptor sequence

>6rkcE (length=372) Species: 519849 (Ureaplasma urealyticum serovar 7 str. ATCC 27819)

KKIITSESVGAGHPDKICDQISDAILDECLSQDQNSRVACEVLACNRLIV
IAGEITTHAYVDVVKTAWEIIKPLGYDENDFTIISNVNKQSVDIAQSVDK
TNKNLIGAGDQGIVFGYACDETPQYMPLTSVLAHELLKEIERQRRSKEFI
KIQADMKSQVSIDYSNSTPLIETMLVSIQHDEDYDVEYFNKKVSAIMEQI
AKKYNLNTNFKKIINSSGRFVIGGPIGDTGLTGRKIIVDTYGGVGHHGGG
AFSGKDPTKVDRSASYFARWIAKNVVAAKLAKQCEIQLAFAIGQPQPVAM
YVNTFNTNLIDETKIFEAIKKSFNFDIKTFINDLNLWTTKYLPVATYGHF
GRDDLDLSWEKLNKVEDLIKNS

3D structure

• PDB: 6rkc The interdimeric interface controls function and stability of Ureaplasma urealiticum methionine S-adenosyltransferase.
• Chain: E
• Resolution: 2.56 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAM	E	H16 P17 D158 S220 F223 D231	H13 P14 D155 S217 F220 D228
BS02	PPK	E	H16 D18 K160 R237 K238	H13 D15 K157 R234 K235
BS03	SAM	E	I58 T60 A62 V64 V90	I55 T57 A59 V61 V87
BS04	PPK	E	D113 G253 K258	D110 G250 K255
BS05	SAM	E	E57 I97 I295	E54 I94 I292
BS06	SAM	E	W71 E81	W68 E78

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 04:51:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6rkc', asym_id = 'E', title = 'The interdimeric interface controls function and...sma urealiticum methionine S-adenosyltransferase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6rkc', asym_id='E', title='The interdimeric interface controls function and...sma urealiticum methionine S-adenosyltransferase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004478,0005524,0006556', uniprot = '', pdbid = '6rkc', asym_id = 'E'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004478,0005524,0006556', uniprot='', pdbid='6rkc', asym_id='E')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>