Structure of PDB 6r6p Chain E

Receptor sequence

>6r6pE (length=236) Species: 9986 (Oryctolagus cuniculus)

PHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYAAPVLATVTKPVGGDKNG
GTRVVKLRKMPRYYPTEDVPRKLLSHGRKPFSQHVRKLRASITPGTILII
LTGRHRGKRVVFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKID
ISGVKIPKHLTDAYFKKKQLRKPRHQEGEIFDTEKEKYEITEQRKVDQKA
VDSQILPKIKAVPQLQGYLRSVFALTNGVYPHKLVF

3D structure

• PDB: 6r6p Structural and mutational analysis of the ribosome-arresting human XBP1u.
• Chain: E
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	P38 H39 C40 S41 R42 N43 R48 Y53 S54 R55 S56 M58 Y59 R61 K62 Y65 K66 R67 K68 Y69 A70 P72 V88 T89 G94 N97 R101 V103 K104 R106 K107 P109 R110 D116 V117 P118 R119 K120 L121 L122 H124 R126 P128 F129 H132 K135 T150 R152 R154 L168 R179 P181 R183 R184 H186 K188 F189 K215 L218 R219 Q224 G226 F229 Y236 K258 P261 Q262 Q264 R268 S269 V270 T274 N275	P1 H2 C3 S4 R5 N6 R11 Y16 S17 R18 S19 M21 Y22 R24 K25 Y28 K29 R30 K31 Y32 A33 P35 V40 T41 G46 N49 R53 V55 K56 R58 K59 P61 R62 D68 V69 P70 R71 K72 L73 L74 H76 R78 P80 F81 H84 K87 T102 R104 R106 L120 R131 P133 R135 R136 H138 K140 F141 K167 L170 R171 Q176 G178 F181 Y188 K210 P213 Q214 Q216 R220 S221 V222 T226 N227

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6r6p, PDBe:6r6p, PDBj:6r6p
• PDBsum: 6r6p
• PubMed: 31246176
• UniProt: G1TG04