Structure of PDB 6r25 Chain E

Receptor sequence
>6r25E (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ
SSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6r25 A Tail-Based Mechanism Drives Nucleosome Demethylation by the LSD2/NPAC Multimeric Complex.
ChainE
Resolution4.61 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E H39 R40 Y41 P43 V46 R49 R63 K64 L65 R69 R83 H4 R5 Y6 P8 V11 R14 R28 K29 L30 R34 R48
BS02 dna E Y41 R42 T45 R72 R83 F84 R116 T118 M120 Y6 R7 T10 R37 R48 F49 R81 T83 M85
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6r25, PDBe:6r25, PDBj:6r25
PDBsum6r25
PubMed30970244
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]