Structure of PDB 6px1 Chain E

Receptor sequence
>6px1E (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6px1 Nucleosome and ubiquitin position Set2 to methylate H3K36.
ChainE
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna E R42 T45 R72 R83 F84 Q85 S86 V117 T118 M120 R6 T9 R36 R47 F48 Q49 S50 V81 T82 M84
BS02 dna E H39 R40 Y41 G44 V46 R49 R63 K64 P66 R69 H3 R4 Y5 G8 V10 R13 R27 K28 P30 R33
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6px1, PDBe:6px1, PDBj:6px1
PDBsum6px1
PubMed31439846
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]