Structure of PDB 6onu Chain E

Receptor sequence
>6onuE (length=72) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
DWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWAL
NTGQDSGVWGGMSEDERRALKR
3D structure
PDB6onu Structural basis of non-canonical transcriptional regulation by the sigma A-bound iron-sulfur protein WhiB1 in M. tuberculosis.
ChainE
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 E A7 C9 C37 C40 T43 C46 G61 A6 C8 C36 C39 T42 C45 G60
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0015035 protein-disulfide reductase activity
GO:0035731 dinitrosyl-iron complex binding
GO:0046872 metal ion binding
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0071731 response to nitric oxide
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6onu, PDBe:6onu, PDBj:6onu
PDBsum6onu
PubMed31807774
UniProtP9WF43|WHIB1_MYCTU Transcriptional regulator WhiB1 (Gene Name=whiB1)

[Back to BioLiP]