Structure of PDB 6neq Chain E

Receptor sequence

>6neqE (length=309) Species: 9913 (Bos taurus)

RRKDLNRGQIIGEGRRGFLWPGLNAPLMKSGAIQTITQRSKEEQEKVEAD
MVQQREEWDRKRKMKVKRERGWSGNSWGGISLGPPDPGPNGETYDDFDTR
ILEVRNVFNMTAKEGRKRSVRVLVAVGNGRGAAGFAIGKATERADAFRKA
KNRAVHYLHYIERYEDHTIYHDISLTFKRTHIKMKKQPRGYGLRCHRAIT
TICRLIGIKDMYAKVSGSVNMLSLTRGLFQGLSRQETHQQLADKKSLHVV
EFREECGPLPIVVASPQGALRKDPEPEDEVPDIKLDWDDVKAVQGMKRSV
WSGLKRAAT

3D structure

• PDB: 6neq Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
• Chain: E
• Resolution: 3.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	S194 G195 R226 V228 F229 N230 M231 A233 K234 R237 R242 I258 K260 D266 R269 K270 R274 Y278 T297 F298 K299 R300 H317 R318 K335 V340 R347 K405 W408 R419 S420 V421 W422 R427	S73 G74 R105 V107 F108 N109 M110 A112 K113 R116 R121 I137 K139 D145 R148 K149 R153 Y157 T176 F177 K178 R179 H196 R197 K214 V219 R226 K284 W287 R298 S299 V300 W301 R306

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6neq, PDBe:6neq, PDBj:6neq
• PDBsum: 6neq
• PubMed: 30677741
• UniProt: Q2KID9|RT05_BOVIN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)